Lineage for d1ynpa1 (1ynp A:1-297)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2080913Superfamily c.1.7: NAD(P)-linked oxidoreductase [51430] (2 families) (S)
  5. 2081379Family c.1.7.0: automated matches [191491] (1 protein)
    not a true family
  6. 2081380Protein automated matches [190793] (26 species)
    not a true protein
  7. 2081381Species Bacillus halodurans [TaxId:272558] [225042] (2 PDB entries)
  8. 2081382Domain d1ynpa1: 1ynp A:1-297 [203208]
    Other proteins in same PDB: d1ynpa2, d1ynpb2
    automated match to d4asth_
    complexed with gol, na, so4, suc

Details for d1ynpa1

PDB Entry: 1ynp (more details), 1.25 Å

PDB Description: aldo-keto reductase akr11c1 from bacillus halodurans (apo form)
PDB Compounds: (A:) Oxidoreductase

SCOPe Domain Sequences for d1ynpa1:

Sequence, based on SEQRES records: (download)

>d1ynpa1 c.1.7.0 (A:1-297) automated matches {Bacillus halodurans [TaxId: 272558]}
mkkrqlgtsdlhvselgfgcmslgtdetkarrimdevlelginyldtadlynqglneqfv
gkalkgrrqdiilatkvgnrfeqgkegwwwdpskayikeavkdslrrlqtdyidlyqlhg
gtiddpidetieafeelkqegviryygissirpnvikeylkrsnivsimmqysildrrpe
ewfpliqehgvsvvvrgpvargllsrrplpegegylnyrydelkllreslptdrplhela
lqyclahdvvatvaagassidqvkanvqaveatpltaeerqhiqklakaavyeqhre

Sequence, based on observed residues (ATOM records): (download)

>d1ynpa1 c.1.7.0 (A:1-297) automated matches {Bacillus halodurans [TaxId: 272558]}
mkkrqlgtsdlhvselgfgcmslgtdetkarrimdevlelginyldtadlynqglneqfv
gkalkgrrqdiilatkvskayikeavkdslrrlqtdyidlyqlhggtiddpidetieafe
elkqegviryygissirpnvikeylkrsnivsimmqysildrrpeewfpliqehgvsvvv
rgpvargllsrrplpegegylnyrydelkllreslptdrplhelalqyclahdvvatvaa
gassidqvkanvqaveatpltaeerqhiqklakaavyeqhre

SCOPe Domain Coordinates for d1ynpa1:

Click to download the PDB-style file with coordinates for d1ynpa1.
(The format of our PDB-style files is described here.)

Timeline for d1ynpa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ynpa2