Lineage for d1yj4a_ (1yj4 A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2731436Fold a.128: Terpenoid synthases [48575] (1 superfamily)
    multihelical; core: 8 helices (C-J) are arranged in 2 parallel layers
  4. 2731437Superfamily a.128.1: Terpenoid synthases [48576] (6 families) (S)
    duplication: two metal-binding sites are related by a pseudo dyad that also relates helices C-F to helices G-J
  5. 2731844Family a.128.1.5: Trichodiene synthase [69113] (1 protein)
    automatically mapped to Pfam PF06330
  6. 2731845Protein Trichodiene synthase [69114] (1 species)
  7. 2731846Species Fusarium sporotrichioides [TaxId:5514] [69115] (20 PDB entries)
  8. 2731853Domain d1yj4a_: 1yj4 A: [203198]
    automated match to d1jfaa_
    complexed with edo

Details for d1yj4a_

PDB Entry: 1yj4 (more details), 2.3 Å

PDB Description: y305f trichodiene synthase
PDB Compounds: (A:) trichodiene synthase

SCOPe Domain Sequences for d1yj4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yj4a_ a.128.1.5 (A:) Trichodiene synthase {Fusarium sporotrichioides [TaxId: 5514]}
menfpteyflnttvrlleyiryrdsnytreerienlhyaynkaahhfaqprqqqllkvdp
krlqaslqtivgmvvyswakvskecmadlsihytytlvlddskddpyptmvnyfddlqag
reqahpwwalvnehfpnvlrhfgpfcslnlirstldffegcwieqynfggfpgshdypqf
lrrmnglghcvgaslwpkeqfnerslfleitsaiaqmenwmvwvndlmsfykefdderdq
islvknyvvsdeislhealekltqdtlhsskqmvavfsdkdpqvmdtiecfmhgyvtwhl
cdrrfrlseiyekvkeektedaqkfckfyeqaanvgavspsewayppvaqlanv

SCOPe Domain Coordinates for d1yj4a_:

Click to download the PDB-style file with coordinates for d1yj4a_.
(The format of our PDB-style files is described here.)

Timeline for d1yj4a_: