Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies) core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145 |
Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) |
Family c.26.1.0: automated matches [191377] (1 protein) not a true family |
Protein automated matches [190459] (59 species) not a true protein |
Species Deinococcus radiodurans [TaxId:1299] [187374] (2 PDB entries) |
Domain d1yidc_: 1yid C: [203197] automated match to d2g36a_ protein/RNA complex; complexed with atp, mg |
PDB Entry: 1yid (more details), 2.4 Å
SCOPe Domain Sequences for d1yidc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yidc_ c.26.1.0 (C:) automated matches {Deinococcus radiodurans [TaxId: 1299]} arprvltgdrptgalhlghlagslqnrvrlqdeaelfvlladvqaltdhfdrpeqvrenv lavaldylaagldpqkttcvvqsavpelaeltvyflnlvtvshlrqnptvkaeiaqkgyg ervpagffvypvsqaadiaafgatlvpvgddqlpmleqtreivrrfnalyapvlaepqaq lsrvprlpgldgqakmskslgnaialgdsadevarkvmgmytdpghlrasdpgrvegnpv ftfldafdpdparvqalkdqyragglgdvkvkkhlidvlngvlapirtrraeyerdpdav lrfvtegtargrevaaqtlgqvrramrlfgh
Timeline for d1yidc_: