Lineage for d1yida_ (1yid A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2468308Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2468309Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 2469071Family c.26.1.0: automated matches [191377] (1 protein)
    not a true family
  6. 2469072Protein automated matches [190459] (59 species)
    not a true protein
  7. 2469168Species Deinococcus radiodurans [TaxId:1299] [187374] (2 PDB entries)
  8. 2469172Domain d1yida_: 1yid A: [203195]
    automated match to d2g36a_
    protein/RNA complex; complexed with atp, mg

Details for d1yida_

PDB Entry: 1yid (more details), 2.4 Å

PDB Description: Crystal structure of tryptophanyl tRNA synthetase II from Deinococcus radiodurans in complex with ATP.
PDB Compounds: (A:) Tryptophanyl-tRNA synthetase

SCOPe Domain Sequences for d1yida_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yida_ c.26.1.0 (A:) automated matches {Deinococcus radiodurans [TaxId: 1299]}
arprvltgdrptgalhlghlagslqnrvrlqdeaelfvlladvqaltdhfdrpeqvrenv
lavaldylaagldpqkttcvvqsavpelaeltvyflnlvtvshlrqnptvkaeiaqkgyg
ervpagffvypvsqaadiaafgatlvpvgddqlpmleqtreivrrfnalyapvlaepqaq
lsrvprlpgldgqakmskslgnaialgdsadevarkvmgmytdpghlrasdpgrvegnpv
ftfldafdpdparvqalkdqyragglgdvkvkkhlidvlngvlapirtrraeyerdpdav
lrfvtegtargrevaaqtlgqvrramrlfgh

SCOPe Domain Coordinates for d1yida_:

Click to download the PDB-style file with coordinates for d1yida_.
(The format of our PDB-style files is described here.)

Timeline for d1yida_: