SCOPe 2.04: Domain d1yi8b_: 1yi8 B:

Lineage for d1yi8b_ (1yi8 B:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
   core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families)

5. Family c.26.1.0: automated matches [191377] (1 protein)
   not a true family

6. Protein automated matches [190459] (36 species)
   not a true protein

7. Species Deinococcus radiodurans [TaxId:243230] [224963] (1 PDB entry)

8. Domain d1yi8b_: 1yi8 B: [203193]
   automated match to d2g36a_
   protein/RNA complex; complexed with trp

Details for d1yi8b_

PDB Entry: 1yi8, 2.1 Å

PDB Description: Crystal structure of tryptophanyl trRNA synthetase II from Deinococcus radiodurans in complex with L-Trp

PDB Compounds: (B:) Tryptophanyl-tRNA synthetase

SCOPe Domain Sequences for d1yi8b_:

Sequence; same for both SEQRES and ATOM records:

>d1yi8b_ c.26.1.0 (B:) automated matches {Deinococcus radiodurans [TaxId: 243230]}
arprvltgdrptgalhlghlagslqnrvrlqdeaelfvlladvqaltdhfdrpeqvrenv
lavaldylaagldpqkttcvvqsavpelaeltvyflnlvtvshlrqnptvkaeiaqkgyg
ervpagffvypvsqaadiaafgatlvpvgddqlpmleqtreivrrfnalyapvlaepqaq
lsrvprlpgldgqakmskslgnaialgdsadevarkvmgmytdpghlrasdpgrvegnpv
ftfldafdpdparvqalkdqyragglgdvkvkkhlidvlngvlapirtrraeyerdpdav
lrfvtegtargrevaaqtlgqvrramrlfgh

Timeline for d1yi8b_:

• d1yi8b_ first appeared in SCOPe 2.03
  
• d1yi8b_ appears in SCOPe 2.05
  
• d1yi8b_ appears in the current release, SCOPe 2.08