SCOPe 2.08: Domain d1yhmb_: 1yhm B:

Lineage for d1yhmb_ (1yhm B:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.128: Terpenoid synthases [48575] (1 superfamily)
   multihelical; core: 8 helices (C-J) are arranged in 2 parallel layers

4. Superfamily a.128.1: Terpenoid synthases [48576] (6 families)
   duplication: two metal-binding sites are related by a pseudo dyad that also relates helices C-F to helices G-J

5. Family a.128.1.0: automated matches [196408] (1 protein)
   not a true family

6. Protein automated matches [196409] (46 species)
   not a true protein

7. Species Trypanosoma cruzi [TaxId:5693] [196823] (68 PDB entries)

8. Domain d1yhmb_: 1yhm B: [203190]
   automated match to d4dwba_
   complexed with ahd, ipe, mg, so4

Details for d1yhmb_

PDB Entry: 1yhm, 2.5 Å

PDB Description: structure of the complex of trypanosoma cruzi farnesyl disphosphate synthase with alendronate, isopentenyl diphosphate and mg+2

PDB Compounds: (B:) farnesyl pyrophosphate synthase

SCOPe Domain Sequences for d1yhmb_:

Sequence; same for both SEQRES and ATOM records:

>d1yhmb_ a.128.1.0 (B:) automated matches {Trypanosoma cruzi [TaxId: 5693]}
masmerflsvydevqaflldqlqskyeidpnrarylrimmdttclggkyfrgmtvvnvae
gflavtqhdeatkerilhdacvggwmieflqahylveddimdgsvmrrgkpcwyrfpgvt
tqcaindgiilkswtqimawhyfadrpflkdllclfqkvdyatavgqmydvtsmcdsnkl
dpevaqpmttdfaeftpaiykrivkykttfytyllplvmglfvseaaasvemnlvervah
ligeyfqvqddvmdcftppeqlgkvgtdiedakcswlavtflgkanaaqvaefkanygdk
dpakvavvkrlyseanlqadfaayeaevvreveslieqlkvksptfaesvavvwekthkr
kk

Timeline for d1yhmb_:

• d1yhmb_ first appeared in SCOPe 2.03
  
• d1yhmb_ appears in SCOPe 2.07