SCOPe 2.06: Domain d1ce1h1: 1ce1 H:1-121

Lineage for d1ce1h1 (1ce1 H:1-121)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [88560] (16 PDB entries)

8. Domain d1ce1h1: 1ce1 H:1-121 [20319]
   Other proteins in same PDB: d1ce1h2, d1ce1l1, d1ce1l2
   part of humanized therapeutic antibody CAMPATH-1H

Details for d1ce1h1

PDB Entry: 1ce1, 1.9 Å

PDB Description: 1.9a structure of the therapeutic antibody campath-1h fab in complex with a synthetic peptide antigen

PDB Compounds: (H:) protein (campath-1h:heavy chain)

SCOPe Domain Sequences for d1ce1h1:

Sequence; same for both SEQRES and ATOM records:

>d1ce1h1 b.1.1.1 (H:1-121) Immunoglobulin heavy chain variable domain, VH {Norway rat (Rattus norvegicus) [TaxId: 10116]}
qvqlqesgpglvrpsqtlsltctvsgftftdfymnwvrqppgrglewigfirdkakgytt
eynpsvkgrvtmlvdtsknqfslrlssvtaadtavyycareghtaapfdywgqgslvtvs
s

Timeline for d1ce1h1:

• d1ce1h1 first appeared (with stable ids) in SCOP 1.55
  
• d1ce1h1 appears in SCOPe 2.05
  
• d1ce1h1 appears in SCOPe 2.07
  
• d1ce1h1 appears in the current release, SCOPe 2.08