Lineage for d1yhma_ (1yhm A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2731436Fold a.128: Terpenoid synthases [48575] (1 superfamily)
    multihelical; core: 8 helices (C-J) are arranged in 2 parallel layers
  4. 2731437Superfamily a.128.1: Terpenoid synthases [48576] (6 families) (S)
    duplication: two metal-binding sites are related by a pseudo dyad that also relates helices C-F to helices G-J
  5. 2731887Family a.128.1.0: automated matches [196408] (1 protein)
    not a true family
  6. 2731888Protein automated matches [196409] (46 species)
    not a true protein
  7. 2732151Species Trypanosoma cruzi [TaxId:5693] [196823] (68 PDB entries)
  8. 2732220Domain d1yhma_: 1yhm A: [203189]
    automated match to d4dwba_
    complexed with ahd, ipe, mg, so4

Details for d1yhma_

PDB Entry: 1yhm (more details), 2.5 Å

PDB Description: structure of the complex of trypanosoma cruzi farnesyl disphosphate synthase with alendronate, isopentenyl diphosphate and mg+2
PDB Compounds: (A:) farnesyl pyrophosphate synthase

SCOPe Domain Sequences for d1yhma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yhma_ a.128.1.0 (A:) automated matches {Trypanosoma cruzi [TaxId: 5693]}
masmerflsvydevqaflldqlqskyeidpnrarylrimmdttclggkyfrgmtvvnvae
gflavtqhdeatkerilhdacvggwmieflqahylveddimdgsvmrrgkpcwyrfpgvt
tqcaindgiilkswtqimawhyfadrpflkdllclfqkvdyatavgqmydvtsmcdsnkl
dpevaqpmttdfaeftpaiykrivkykttfytyllplvmglfvseaaasvemnlvervah
ligeyfqvqddvmdcftppeqlgkvgtdiedakcswlavtflgkanaaqvaefkanygdk
dpakvavvkrlyseanlqadfaayeaevvreveslieqlkvksptfaesvavvwekthkr
kk

SCOPe Domain Coordinates for d1yhma_:

Click to download the PDB-style file with coordinates for d1yhma_.
(The format of our PDB-style files is described here.)

Timeline for d1yhma_: