Lineage for d1ygab_ (1yga B:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2391115Fold b.30: Supersandwich [49993] (3 superfamilies)
    sandwich; 18 strands in 2 sheets
  4. 2391261Superfamily b.30.5: Galactose mutarotase-like [74650] (12 families) (S)
    probable carbohydrate-binding domain in enzymes acting on sugars
  5. 2391750Family b.30.5.0: automated matches [227145] (1 protein)
    not a true family
  6. 2391751Protein automated matches [226849] (8 species)
    not a true protein
  7. 2391758Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [224957] (1 PDB entry)
  8. 2391760Domain d1ygab_: 1yga B: [203186]
    automated match to d1lura_

Details for d1ygab_

PDB Entry: 1yga (more details), 2 Å

PDB Description: crystal structure of saccharomyces cerevisiae yn9a protein, new york structural genomics consortium
PDB Compounds: (B:) Hypothetical 37.9 kDa protein in BIO3-HXT17 intergenic region

SCOPe Domain Sequences for d1ygab_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ygab_ b.30.5.0 (B:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
dnkygvitigdekkfqatiaplgatlvdlkvngqsvvqgysnvqdyltdgnmmgatvgry
anriakgvfslddgphkltvnncgntnhssisslnlkqykaspvenpskgvyvvefklld
dhtqpnpnefpgdlevtvkytlnvaemtldmeyqaqlvrgdatpinmtnhsyfnlnkvks
eksirgtevkvcsnkslevtegallptgkiierniatfdstkptvlhedtpvfdctfiid
ankdlkttdsvsvnklvpvfkayhpeshikfevstteptvhlytgdnlcgkfvprsgfav
qqgryvdainrdewrgcvllkrgevytsktqykfdi

SCOPe Domain Coordinates for d1ygab_:

Click to download the PDB-style file with coordinates for d1ygab_.
(The format of our PDB-style files is described here.)

Timeline for d1ygab_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1ygaa_