SCOPe 2.06: Domain d1xxga2: 1xxg A:116-233

Lineage for d1xxga2 (1xxg A:116-233)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (2 families)

5. Family d.15.6.0: automated matches [227139] (1 protein)
   not a true family

6. Protein automated matches [226841] (5 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:1280] [225055] (8 PDB entries)

8. Domain d1xxga2: 1xxg A:116-233 [203180]
   Other proteins in same PDB: d1xxga1
   automated match to d1d5zc2
   complexed with so4

Details for d1xxga2

PDB Entry: 1xxg, 2.2 Å

PDB Description: Crystal Structure of Staphylococcal Enterotoxin G

PDB Compounds: (A:) enterotoxin

SCOPe Domain Sequences for d1xxga2:

Sequence, based on SEQRES records:

>d1xxga2 d.15.6.0 (A:116-233) automated matches {Staphylococcus aureus [TaxId: 1280]}
nssenerdklitvqvtidnrqslgftittnknmvtiqeldykarhwltkekklyefdgsa
fesgyikfteknntsfwfdlfpkkelvpfvpykflniygdnkvvdsksikmevflnth

Sequence, based on observed residues (ATOM records):

>d1xxga2 d.15.6.0 (A:116-233) automated matches {Staphylococcus aureus [TaxId: 1280]}
nssenrdklitvqvtidnrqslgftittnknmvtiqeldykarhwltkekklyefdgsaf
esgyikfteknntsfwfdlfpkkelvpfvpykflniygdnkvvdsksikmevflnth

Timeline for d1xxga2:

• d1xxga2 first appeared in SCOPe 2.03
  
• d1xxga2 appears in SCOPe 2.05
  
• d1xxga2 appears in the current release, SCOPe 2.07