Lineage for d1ce1l1 (1ce1 L:1-107)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2740696Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species)
    VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 2741585Species Norway rat (Rattus norvegicus) [TaxId:10116] [88532] (14 PDB entries)
  8. 2741588Domain d1ce1l1: 1ce1 L:1-107 [20318]
    Other proteins in same PDB: d1ce1h1, d1ce1h2, d1ce1h3, d1ce1l2
    part of humanized therapeutic antibody CAMPATH-1H

Details for d1ce1l1

PDB Entry: 1ce1 (more details), 1.9 Å

PDB Description: 1.9a structure of the therapeutic antibody campath-1h fab in complex with a synthetic peptide antigen
PDB Compounds: (L:) protein (campath-1h:light chain)

SCOPe Domain Sequences for d1ce1l1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ce1l1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Norway rat (Rattus norvegicus) [TaxId: 10116]}
diqmtqspsslsasvgdrvtitckasqnidkylnwyqqkpgkapklliyntnnlqtgvps
rfsgsgsgtdftftisslqpediatyyclqhisrprtfgqgtkveik

SCOPe Domain Coordinates for d1ce1l1:

Click to download the PDB-style file with coordinates for d1ce1l1.
(The format of our PDB-style files is described here.)

Timeline for d1ce1l1: