Class b: All beta proteins [48724] (174 folds) |
Fold b.40: OB-fold [50198] (16 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families) |
Family b.40.2.0: automated matches [227133] (1 protein) not a true family |
Protein automated matches [226834] (4 species) not a true protein |
Species Staphylococcus aureus [TaxId:1280] [225054] (6 PDB entries) |
Domain d1xxga1: 1xxg A:1-115 [203179] Other proteins in same PDB: d1xxga2 automated match to d1d5zc1 complexed with so4 |
PDB Entry: 1xxg (more details), 2.2 Å
SCOPe Domain Sequences for d1xxga1:
Sequence, based on SEQRES records: (download)
>d1xxga1 b.40.2.0 (A:1-115) automated matches {Staphylococcus aureus [TaxId: 1280]} qpdpkldelnkvsdyksnkgtmgnvmnlymsppvegrgvinsrqflshdlifpieyksyn evktelentelannykgkkvdifgvpyfytciipksepdinqnfggccmyggltf
>d1xxga1 b.40.2.0 (A:1-115) automated matches {Staphylococcus aureus [TaxId: 1280]} qpdpkldelnkvsdyksnkgtmgnvmnlymsppvegrgvinsrqflshdlifpieyksyn evktelentelannykgkkvdifgvpyfytciipksepfggccmyggltf
Timeline for d1xxga1: