SCOPe 2.04: Domain d1xx5c1: 1xx5 C:10-164

Lineage for d1xx5c1 (1xx5 C:10-164)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.111: PR-1-like [55796] (1 superfamily)
   alpha-beta-alpha-beta-alpha(2)-beta(2); 3 layers, alpha/beta/alpha; mixed sheet: order 1342

4. Superfamily d.111.1: PR-1-like [55797] (2 families)

5. Family d.111.1.1: PR-1-like [55798] (5 proteins)
   Pfam PF00188; groups mammalian SCP/TPX1; insects AG3/AG5; fungi SC7/SC14 and plant PR-1

6. Protein automated matches [194852] (3 species)
   not a true protein

7. Species Chinese cobra (Naja atra) [TaxId:8656] [224984] (4 PDB entries)

8. Domain d1xx5c1: 1xx5 C:10-164 [203177]
   Other proteins in same PDB: d1xx5a2, d1xx5b2, d1xx5c2
   automated match to d1rc9a1
   complexed with eoh

Details for d1xx5c1

PDB Entry: 1xx5, 2.4 Å

PDB Description: Crystal Structure of Natrin from Naja atra snake venom

PDB Compounds: (C:) Natrin 1

SCOPe Domain Sequences for d1xx5c1:

Sequence; same for both SEQRES and ATOM records:

>d1xx5c1 d.111.1.1 (C:10-164) automated matches {Chinese cobra (Naja atra) [TaxId: 8656]}
rrkkkqkeivdlhnslrrrvsptasnmlkmewypeaasnaerwantcslnhspdnlrvle
giqcgesiymssnartwteiihlwhdeyknfvygvganppgsvtghytqivwyqtyragc
avsycpssawsyfyvcqycpsgnfqgktatpyklg

Timeline for d1xx5c1:

• d1xx5c1 first appeared in SCOPe 2.03
  
• d1xx5c1 appears in SCOPe 2.05
  
• d1xx5c1 appears in the current release, SCOPe 2.08