Lineage for d1xx5a2 (1xx5 A:165-221)

  1. Root: SCOPe 2.03
  2. 1458801Class g: Small proteins [56992] (90 folds)
  3. 1462301Fold g.19: Crisp domain-like [57545] (1 superfamily)
    disulfide-rich all-alpha fold
  4. 1462302Superfamily g.19.1: Crisp domain-like [57546] (3 families) (S)
  5. 1462315Family g.19.1.0: automated matches [227153] (1 protein)
    not a true family
  6. 1462316Protein automated matches [226858] (4 species)
    not a true protein
  7. 1462317Species Chinese cobra (Naja atra) [TaxId:8656] [224985] (4 PDB entries)
  8. 1462322Domain d1xx5a2: 1xx5 A:165-221 [203174]
    Other proteins in same PDB: d1xx5a1, d1xx5b1, d1xx5c1
    automated match to d1rc9a2
    complexed with eoh

Details for d1xx5a2

PDB Entry: 1xx5 (more details), 2.4 Å

PDB Description: Crystal Structure of Natrin from Naja atra snake venom
PDB Compounds: (A:) Natrin 1

SCOPe Domain Sequences for d1xx5a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xx5a2 g.19.1.0 (A:165-221) automated matches {Chinese cobra (Naja atra) [TaxId: 8656]}
ppcgdcpsacdnglctnpctiynkltncdsllkqsscqddwiksncpascfcrnkii

SCOPe Domain Coordinates for d1xx5a2:

Click to download the PDB-style file with coordinates for d1xx5a2.
(The format of our PDB-style files is described here.)

Timeline for d1xx5a2:

1462322
d1xx5a2 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d1xx5a1