![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.111: PR-1-like [55796] (1 superfamily) alpha-beta-alpha-beta-alpha(2)-beta(2); 3 layers, alpha/beta/alpha; mixed sheet: order 1342 |
![]() | Superfamily d.111.1: PR-1-like [55797] (2 families) ![]() |
![]() | Family d.111.1.1: PR-1-like [55798] (5 proteins) Pfam PF00188; groups mammalian SCP/TPX1; insects AG3/AG5; fungi SC7/SC14 and plant PR-1 |
![]() | Protein automated matches [194852] (3 species) not a true protein |
![]() | Species Chinese cobra (Naja atra) [TaxId:8656] [224984] (4 PDB entries) |
![]() | Domain d1xx5a1: 1xx5 A:6-164 [203173] Other proteins in same PDB: d1xx5a2, d1xx5b2, d1xx5c2 automated match to d1rc9a1 complexed with eoh |
PDB Entry: 1xx5 (more details), 2.4 Å
SCOPe Domain Sequences for d1xx5a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xx5a1 d.111.1.1 (A:6-164) automated matches {Chinese cobra (Naja atra) [TaxId: 8656]} sestrrkkkqkeivdlhnslrrrvsptasnmlkmewypeaasnaerwantcslnhspdnl rvlegiqcgesiymssnartwteiihlwhdeyknfvygvganppgsvtghytqivwyqty ragcavsycpssawsyfyvcqycpsgnfqgktatpyklg
Timeline for d1xx5a1:
![]() Domains from other chains: (mouse over for more information) d1xx5b1, d1xx5b2, d1xx5c1, d1xx5c2 |