SCOPe 2.08: Domain d1xuqb1: 1xuq B:3-92

Lineage for d1xuqb1 (1xuq B:3-92)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
   2 helices; antiparallel hairpin, left-handed twist

4. Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (2 families)
   automatically mapped to Pfam PF00081

5. Family a.2.11.0: automated matches [227154] (1 protein)
   not a true family

6. Protein automated matches [226859] (39 species)
   not a true protein

7. Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [224993] (2 PDB entries)

8. Domain d1xuqb1: 1xuq B:3-92 [203171]
   Other proteins in same PDB: d1xuqa2, d1xuqb2
   automated match to d1unfx1
   complexed with mn

Details for d1xuqb1

PDB Entry: 1xuq, 1.8 Å

PDB Description: Crystal Structure of SodA-1 (BA4499) from Bacillus anthracis at 1.8A Resolution.

PDB Compounds: (B:) superoxide dismutase

SCOPe Domain Sequences for d1xuqb1:

Sequence; same for both SEQRES and ATOM records:

>d1xuqb1 a.2.11.0 (B:3-92) automated matches {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]}
khelpnlpyaydalephfdketmnihhtkhhntyitnlnaaleghaeladksveelvanl
nevpeairtavrnnggghanhtffwtilsp

Timeline for d1xuqb1:

• d1xuqb1 first appeared in SCOPe 2.03
  
• d1xuqb1 appears in SCOPe 2.07