Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily) alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213 |
Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families) automatically mapped to Pfam PF02777 |
Family d.44.1.0: automated matches [227155] (1 protein) not a true family |
Protein automated matches [226860] (37 species) not a true protein |
Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [224994] (2 PDB entries) |
Domain d1xuqa2: 1xuq A:93-202 [203170] Other proteins in same PDB: d1xuqa1, d1xuqb1 automated match to d1unfx2 complexed with mn |
PDB Entry: 1xuq (more details), 1.8 Å
SCOPe Domain Sequences for d1xuqa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xuqa2 d.44.1.0 (A:93-202) automated matches {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]} ngggqpvgelataieakfgsfdafkeefakagatrfgsgwawlvvnngelevtstpnqds pltegktpvigldvwehayylnyqnrrpdyigafwnvvdwnaaekryqea
Timeline for d1xuqa2: