Lineage for d1xuqa2 (1xuq A:93-202)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2946001Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily)
    alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213
  4. 2946002Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families) (S)
    automatically mapped to Pfam PF02777
  5. 2946299Family d.44.1.0: automated matches [227155] (1 protein)
    not a true family
  6. 2946300Protein automated matches [226860] (38 species)
    not a true protein
  7. 2946337Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [224994] (2 PDB entries)
  8. 2946340Domain d1xuqa2: 1xuq A:93-202 [203170]
    Other proteins in same PDB: d1xuqa1, d1xuqb1
    automated match to d1unfx2
    complexed with mn

Details for d1xuqa2

PDB Entry: 1xuq (more details), 1.8 Å

PDB Description: Crystal Structure of SodA-1 (BA4499) from Bacillus anthracis at 1.8A Resolution.
PDB Compounds: (A:) superoxide dismutase

SCOPe Domain Sequences for d1xuqa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xuqa2 d.44.1.0 (A:93-202) automated matches {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]}
ngggqpvgelataieakfgsfdafkeefakagatrfgsgwawlvvnngelevtstpnqds
pltegktpvigldvwehayylnyqnrrpdyigafwnvvdwnaaekryqea

SCOPe Domain Coordinates for d1xuqa2:

Click to download the PDB-style file with coordinates for d1xuqa2.
(The format of our PDB-style files is described here.)

Timeline for d1xuqa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1xuqa1