Lineage for d1bfoh1 (1bfo H:1-121)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 362615Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 362616Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 362617Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (24 proteins)
  6. 362751Protein Immunoglobulin heavy chain variable domain, VH [88543] (20 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 363391Species Rat (Rattus norvegicus) [TaxId:10116] [88560] (14 PDB entries)
  8. 363407Domain d1bfoh1: 1bfo H:1-121 [20317]
    Other proteins in same PDB: d1bfoa1, d1bfoa2, d1bfob2, d1bfoc1, d1bfoc2, d1bfod2, d1bfoe1, d1bfoe2, d1bfof2, d1bfog1, d1bfog2, d1bfoh2
    part of therapeutic monoclonal antibody CAMPATH-1G

Details for d1bfoh1

PDB Entry: 1bfo (more details), 2.6 Å

PDB Description: campath-1g igg2b rat monoclonal fab

SCOP Domain Sequences for d1bfoh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bfoh1 b.1.1.1 (H:1-121) Immunoglobulin heavy chain variable domain, VH {Rat (Rattus norvegicus)}
evkllesggglvqpggsmrlscagsgftftdfymnwirqpagkapewlgfirdkakgytt
eynpsvkgrftisrdntqnmlylqmntlraedtatyycareghtaapfdywgqgvmvtvs
s

SCOP Domain Coordinates for d1bfoh1:

Click to download the PDB-style file with coordinates for d1bfoh1.
(The format of our PDB-style files is described here.)

Timeline for d1bfoh1: