| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.2: Long alpha-hairpin [46556] (20 superfamilies) 2 helices; antiparallel hairpin, left-handed twist |
Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (2 families) ![]() automatically mapped to Pfam PF00081 |
| Family a.2.11.0: automated matches [227154] (1 protein) not a true family |
| Protein automated matches [226859] (39 species) not a true protein |
| Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [224993] (2 PDB entries) |
| Domain d1xuqa1: 1xuq A:3-92 [203169] Other proteins in same PDB: d1xuqa2, d1xuqb2 automated match to d1unfx1 complexed with mn |
PDB Entry: 1xuq (more details), 1.8 Å
SCOPe Domain Sequences for d1xuqa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xuqa1 a.2.11.0 (A:3-92) automated matches {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]}
khelpnlpyaydalephfdketmnihhtkhhntyitnlnaaleghaeladksveelvanl
nevpeairtavrnnggghanhtffwtilsp
Timeline for d1xuqa1: