Lineage for d1xuqa1 (1xuq A:3-92)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2689745Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
    2 helices; antiparallel hairpin, left-handed twist
  4. 2690049Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (2 families) (S)
    automatically mapped to Pfam PF00081
  5. 2690339Family a.2.11.0: automated matches [227154] (1 protein)
    not a true family
  6. 2690340Protein automated matches [226859] (39 species)
    not a true protein
  7. 2690377Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [224993] (2 PDB entries)
  8. 2690380Domain d1xuqa1: 1xuq A:3-92 [203169]
    Other proteins in same PDB: d1xuqa2, d1xuqb2
    automated match to d1unfx1
    complexed with mn

Details for d1xuqa1

PDB Entry: 1xuq (more details), 1.8 Å

PDB Description: Crystal Structure of SodA-1 (BA4499) from Bacillus anthracis at 1.8A Resolution.
PDB Compounds: (A:) superoxide dismutase

SCOPe Domain Sequences for d1xuqa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xuqa1 a.2.11.0 (A:3-92) automated matches {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]}
khelpnlpyaydalephfdketmnihhtkhhntyitnlnaaleghaeladksveelvanl
nevpeairtavrnnggghanhtffwtilsp

SCOPe Domain Coordinates for d1xuqa1:

Click to download the PDB-style file with coordinates for d1xuqa1.
(The format of our PDB-style files is described here.)

Timeline for d1xuqa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1xuqa2