Lineage for d1xtld_ (1xtl D:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1298458Superfamily b.1.8: Cu,Zn superoxide dismutase-like [49329] (2 families) (S)
    has additional strand at N-terminus
  5. 1298952Family b.1.8.0: automated matches [191527] (1 protein)
    not a true family
  6. 1298953Protein automated matches [190890] (2 species)
    not a true protein
  7. 1298954Species Bacillus subtilis [TaxId:1423] [224973] (3 PDB entries)
  8. 1298964Domain d1xtld_: 1xtl D: [203166]
    automated match to d1do5d_
    complexed with cu, zn; mutant

Details for d1xtld_

PDB Entry: 1xtl (more details), 2 Å

PDB Description: Crystal structure of P104H mutant of SOD-like protein from Bacillus subtilis.
PDB Compounds: (D:) Hypothetical superoxide dismutase-like protein yojM

SCOPe Domain Sequences for d1xtld_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xtld_ b.1.8.0 (D:) automated matches {Bacillus subtilis [TaxId: 1423]}
afghhvqlvnregkavgfieikesddegldihisanslrpgaslgfhiyekgscvrpdfe
sagghfnplnkehgfnnpmghhagdlpnlevgadgkvdvimnapdtslkkgsklnilded
gsafiiheqaddyltnpsgnsgarivcgallg

SCOPe Domain Coordinates for d1xtld_:

Click to download the PDB-style file with coordinates for d1xtld_.
(The format of our PDB-style files is described here.)

Timeline for d1xtld_: