Class b: All beta proteins [48724] (176 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.8: Cu,Zn superoxide dismutase-like [49329] (2 families) has additional strand at N-terminus |
Family b.1.8.0: automated matches [191527] (1 protein) not a true family |
Protein automated matches [190890] (5 species) not a true protein |
Species Bacillus subtilis [TaxId:1423] [224973] (4 PDB entries) |
Domain d1xtlb_: 1xtl B: [203164] automated match to d1do5d_ complexed with cu, zn; mutant |
PDB Entry: 1xtl (more details), 2 Å
SCOPe Domain Sequences for d1xtlb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xtlb_ b.1.8.0 (B:) automated matches {Bacillus subtilis [TaxId: 1423]} afghhvqlvnregkavgfieikesddegldihisanslrpgaslgfhiyekgscvrpdfe sagghfnplnkehgfnnpmghhagdlpnlevgadgkvdvimnapdtslkkgsklnilded gsafiiheqaddyltnpsgnsgarivcgallg
Timeline for d1xtlb_: