SCOPe 2.03: Domain d1xtlb_: 1xtl B:

Lineage for d1xtlb_ (1xtl B:)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.8: Cu,Zn superoxide dismutase-like [49329] (2 families)
   has additional strand at N-terminus

5. Family b.1.8.0: automated matches [191527] (1 protein)
   not a true family

6. Protein automated matches [190890] (2 species)
   not a true protein

7. Species Bacillus subtilis [TaxId:1423] [224973] (3 PDB entries)

8. Domain d1xtlb_: 1xtl B: [203164]
   automated match to d1do5d_
   complexed with cu, zn; mutant

Details for d1xtlb_

PDB Entry: 1xtl, 2 Å

PDB Description: crystal structure of p104h mutant of sod-like protein from bacillus subtilis.

PDB Compounds: (B:) Hypothetical superoxide dismutase-like protein yojM

SCOPe Domain Sequences for d1xtlb_:

Sequence; same for both SEQRES and ATOM records:

>d1xtlb_ b.1.8.0 (B:) automated matches {Bacillus subtilis [TaxId: 1423]}
afghhvqlvnregkavgfieikesddegldihisanslrpgaslgfhiyekgscvrpdfe
sagghfnplnkehgfnnpmghhagdlpnlevgadgkvdvimnapdtslkkgsklnilded
gsafiiheqaddyltnpsgnsgarivcgallg

Timeline for d1xtlb_:

• d1xtlb_ is new in SCOPe 2.03-stable
  
• d1xtlb_ appears in SCOPe 2.04
  
• d1xtlb_ appears in the current release, SCOPe 2.08