| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.8: Cu,Zn superoxide dismutase-like [49329] (2 families) ![]() has additional strand at N-terminus |
| Family b.1.8.0: automated matches [191527] (1 protein) not a true family |
| Protein automated matches [190890] (7 species) not a true protein |
| Species Bacillus subtilis [TaxId:1423] [224973] (4 PDB entries) |
| Domain d1xtlb_: 1xtl B: [203164] automated match to d1do5d_ complexed with cu, zn; mutant |
PDB Entry: 1xtl (more details), 2 Å
SCOPe Domain Sequences for d1xtlb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xtlb_ b.1.8.0 (B:) automated matches {Bacillus subtilis [TaxId: 1423]}
afghhvqlvnregkavgfieikesddegldihisanslrpgaslgfhiyekgscvrpdfe
sagghfnplnkehgfnnpmghhagdlpnlevgadgkvdvimnapdtslkkgsklnilded
gsafiiheqaddyltnpsgnsgarivcgallg
Timeline for d1xtlb_: