Lineage for d1xtla_ (1xtl A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2763708Superfamily b.1.8: Cu,Zn superoxide dismutase-like [49329] (2 families) (S)
    has additional strand at N-terminus
  5. 2764467Family b.1.8.0: automated matches [191527] (1 protein)
    not a true family
  6. 2764468Protein automated matches [190890] (7 species)
    not a true protein
  7. 2764469Species Bacillus subtilis [TaxId:1423] [224973] (4 PDB entries)
  8. 2764476Domain d1xtla_: 1xtl A: [203163]
    automated match to d1do5d_
    complexed with cu, zn; mutant

Details for d1xtla_

PDB Entry: 1xtl (more details), 2 Å

PDB Description: crystal structure of p104h mutant of sod-like protein from bacillus subtilis.
PDB Compounds: (A:) Hypothetical superoxide dismutase-like protein yojM

SCOPe Domain Sequences for d1xtla_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xtla_ b.1.8.0 (A:) automated matches {Bacillus subtilis [TaxId: 1423]}
afghhvqlvnregkavgfieikesddegldihisanslrpgaslgfhiyekgscvrpdfe
sagghfnplnkehgfnnpmghhagdlpnlevgadgkvdvimnapdtslkkgsklnilded
gsafiiheqaddyltnpsgnsgarivcgallg

SCOPe Domain Coordinates for d1xtla_:

Click to download the PDB-style file with coordinates for d1xtla_.
(The format of our PDB-style files is described here.)

Timeline for d1xtla_: