Lineage for d1xtaa2 (1xta A:165-221)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3034336Fold g.19: Crisp domain-like [57545] (1 superfamily)
    disulfide-rich all-alpha fold
  4. 3034337Superfamily g.19.1: Crisp domain-like [57546] (3 families) (S)
  5. 3034350Family g.19.1.0: automated matches [227153] (1 protein)
    not a true family
  6. 3034351Protein automated matches [226858] (5 species)
    not a true protein
  7. 3034352Species Chinese cobra (Naja atra) [TaxId:8656] [224985] (4 PDB entries)
  8. 3034353Domain d1xtaa2: 1xta A:165-221 [203160]
    Other proteins in same PDB: d1xtaa1, d1xtab1
    automated match to d1rc9a2

Details for d1xtaa2

PDB Entry: 1xta (more details), 1.58 Å

PDB Description: Crystal Structure of Natrin, a snake venom CRISP from Taiwan cobra (Naja atra)
PDB Compounds: (A:) Natrin 1

SCOPe Domain Sequences for d1xtaa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xtaa2 g.19.1.0 (A:165-221) automated matches {Chinese cobra (Naja atra) [TaxId: 8656]}
ppcgdcpsacdnglctnpctiynkltncdsllkqsscqddwiksncpascfcrnkii

SCOPe Domain Coordinates for d1xtaa2:

Click to download the PDB-style file with coordinates for d1xtaa2.
(The format of our PDB-style files is described here.)

Timeline for d1xtaa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1xtaa1