![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.111: PR-1-like [55796] (1 superfamily) alpha-beta-alpha-beta-alpha(2)-beta(2); 3 layers, alpha/beta/alpha; mixed sheet: order 1342 |
![]() | Superfamily d.111.1: PR-1-like [55797] (2 families) ![]() |
![]() | Family d.111.1.1: PR-1-like [55798] (5 proteins) Pfam PF00188; groups mammalian SCP/TPX1; insects AG3/AG5; fungi SC7/SC14 and plant PR-1 |
![]() | Protein automated matches [194852] (4 species) not a true protein |
![]() | Species Chinese cobra (Naja atra) [TaxId:8656] [224984] (4 PDB entries) |
![]() | Domain d1xtaa1: 1xta A:2-164 [203159] Other proteins in same PDB: d1xtaa2, d1xtab2 automated match to d1rc9a1 |
PDB Entry: 1xta (more details), 1.58 Å
SCOPe Domain Sequences for d1xtaa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xtaa1 d.111.1.1 (A:2-164) automated matches {Chinese cobra (Naja atra) [TaxId: 8656]} vdfnsestrrkkkqkeivdlhnslrrrvsptasnmlkmewypeaasnaerwantcslnhs pdnlrvlegiqcgesiymssnartwteiihlwhdeyknfvygvgasppgsvtghytqivw yqtyragcavsycpssawsyfyvcqycpsgnfqgktatpyklg
Timeline for d1xtaa1: