Lineage for d1xreb1 (1xre B:3-92)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1718782Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
    2 helices; antiparallel hairpin, left-handed twist
  4. 1719057Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (2 families) (S)
    automatically mapped to Pfam PF00081
  5. 1719324Family a.2.11.0: automated matches [227154] (1 protein)
    not a true family
  6. 1719325Protein automated matches [226859] (31 species)
    not a true protein
  7. 1719349Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [224993] (2 PDB entries)
  8. 1719351Domain d1xreb1: 1xre B:3-92 [203157]
    Other proteins in same PDB: d1xrea2, d1xreb2
    automated match to d1jr9a1
    complexed with mn

Details for d1xreb1

PDB Entry: 1xre (more details), 1.8 Å

PDB Description: Crystal Structure of SodA-2 (BA5696) from Bacillus anthracis at 1.8A Resolution.
PDB Compounds: (B:) superoxide dismutase

SCOPe Domain Sequences for d1xreb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xreb1 a.2.11.0 (B:3-92) automated matches {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]}
sfqlpklsydydelepyidsntlsihhgkhhatyvnnlnaalenyselhnksleellcnl
etlpkeivtavrnnggghychslfwevmsp

SCOPe Domain Coordinates for d1xreb1:

Click to download the PDB-style file with coordinates for d1xreb1.
(The format of our PDB-style files is described here.)

Timeline for d1xreb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1xreb2