SCOPe 2.03: Domain d1xrea1: 1xre A:3-92

Lineage for d1xrea1 (1xre A:3-92)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
   2 helices; antiparallel hairpin, left-handed twist

4. Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (2 families)
   automatically mapped to Pfam PF00081

5. Family a.2.11.0: automated matches [227154] (1 protein)
   not a true family

6. Protein automated matches [226859] (26 species)
   not a true protein

7. Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [224993] (2 PDB entries)

8. Domain d1xrea1: 1xre A:3-92 [203155]
   Other proteins in same PDB: d1xrea2, d1xreb2
   automated match to d1jr9a1
   complexed with mn

Details for d1xrea1

PDB Entry: 1xre, 1.8 Å

PDB Description: Crystal Structure of SodA-2 (BA5696) from Bacillus anthracis at 1.8A Resolution.

PDB Compounds: (A:) superoxide dismutase

SCOPe Domain Sequences for d1xrea1:

Sequence; same for both SEQRES and ATOM records:

>d1xrea1 a.2.11.0 (A:3-92) automated matches {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]}
sfqlpklsydydelepyidsntlsihhgkhhatyvnnlnaalenyselhnksleellcnl
etlpkeivtavrnnggghychslfwevmsp

Timeline for d1xrea1:

• d1xrea1 is new in SCOPe 2.03-stable
  
• d1xrea1 appears in SCOPe 2.04
  
• d1xrea1 appears in the current release, SCOPe 2.08