SCOPe 2.08: Domain d1xeua2: 1xeu A:217-297

Lineage for d1xeua2 (1xeu A:217-297)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (27 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.0: automated matches [191341] (1 protein)
   not a true family

6. Protein automated matches [190226] (81 species)
   not a true protein

7. Species Listeria monocytogenes [TaxId:1639] [225010] (2 PDB entries)

8. Domain d1xeua2: 1xeu A:217-297 [203142]
   Other proteins in same PDB: d1xeua1
   automated match to d1m9sa1

Details for d1xeua2

PDB Entry: 1xeu, 2.05 Å

PDB Description: Crystal Structure of Internalin C from Listeria monocytogenes

PDB Compounds: (A:) internalin C

SCOPe Domain Sequences for d1xeua2:

Sequence; same for both SEQRES and ATOM records:

>d1xeua2 b.1.18.0 (A:217-297) automated matches {Listeria monocytogenes [TaxId: 1639]}
kcvnepvkyqpelyitntvkdpdgrwispyyisnggsyvdgcvlwelpvytdevsykfse
yinvgeteaifdgtvtqpikn

Timeline for d1xeua2:

• d1xeua2 first appeared in SCOPe 2.03
  
• d1xeua2 appears in SCOPe 2.07