Lineage for d1xeua1 (1xeu A:35-216)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2851636Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (3 superfamilies)
    2 curved layers, a/b; parallel beta-sheet; order 1234...N; there are sequence similarities between different superfamilies
  4. 2851705Superfamily c.10.2: L domain-like [52058] (9 families) (S)
    less regular structure consisting of variable repeats
  5. 2851922Family c.10.2.0: automated matches [191489] (1 protein)
    not a true family
  6. 2851923Protein automated matches [190787] (14 species)
    not a true protein
  7. 2851991Species Listeria monocytogenes [TaxId:1639] [225009] (1 PDB entry)
  8. 2851992Domain d1xeua1: 1xeu A:35-216 [203141]
    Other proteins in same PDB: d1xeua2
    automated match to d1m9sa5

Details for d1xeua1

PDB Entry: 1xeu (more details), 2.05 Å

PDB Description: Crystal Structure of Internalin C from Listeria monocytogenes
PDB Compounds: (A:) internalin C

SCOPe Domain Sequences for d1xeua1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xeua1 c.10.2.0 (A:35-216) automated matches {Listeria monocytogenes [TaxId: 1639]}
esiqrptpinqvfpdpglanavkqnlgkqsvtdlvsqkelsgvqnfngdnsniqslagmq
fftnlkelhlshnqisdlsplkdltkleelsvnrnrlknlngipsaclsrlfldnnelrd
tdslihlknleilsirnnklksivmlgflsklevldlhgneitntggltrlkkvnwidlt
gq

SCOPe Domain Coordinates for d1xeua1:

Click to download the PDB-style file with coordinates for d1xeua1.
(The format of our PDB-style files is described here.)

Timeline for d1xeua1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1xeua2