Lineage for d1bfoe1 (1bfo E:1-107)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 362615Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 362616Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 362617Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (24 proteins)
  6. 363425Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (14 species)
    VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 364043Species Rat (Rattus norvegicus) [TaxId:10116] [88532] (7 PDB entries)
  8. 364049Domain d1bfoe1: 1bfo E:1-107 [20314]
    Other proteins in same PDB: d1bfoa2, d1bfob1, d1bfob2, d1bfoc2, d1bfod1, d1bfod2, d1bfoe2, d1bfof1, d1bfof2, d1bfog2, d1bfoh1, d1bfoh2

Details for d1bfoe1

PDB Entry: 1bfo (more details), 2.6 Å

PDB Description: campath-1g igg2b rat monoclonal fab

SCOP Domain Sequences for d1bfoe1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bfoe1 b.1.1.1 (E:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Rat (Rattus norvegicus)}
dikmtqspsflsasvgdrvtlnckasqnidkylnwyqqklgespklliyntnnlqtgips
rfsgsgsgtdftltisslqpedvatyfclqhisrprtfgtgtklelk

SCOP Domain Coordinates for d1bfoe1:

Click to download the PDB-style file with coordinates for d1bfoe1.
(The format of our PDB-style files is described here.)

Timeline for d1bfoe1: