| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.95: Thiolase-like [53900] (1 superfamily) consists of two similar domains related by pseudo dyad; duplication 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest |
Superfamily c.95.1: Thiolase-like [53901] (3 families) ![]() |
| Family c.95.1.0: automated matches [196908] (1 protein) not a true family |
| Protein automated matches [196909] (83 species) not a true protein |
| Species Scots pine (Pinus sylvestris) [TaxId:3349] [225067] (3 PDB entries) |
| Domain d1xetb2: 1xet B:239-392 [203136] automated match to d1bi5a2 complexed with 3io, mca |
PDB Entry: 1xet (more details), 2 Å
SCOPe Domain Sequences for d1xetb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xetb2 c.95.1.0 (B:239-392) automated matches {Scots pine (Pinus sylvestris) [TaxId: 3349]}
cfeivwtaqtvvpnsegaiggkvrevgltfqlkgavpdlisaniencmveafsqfkisdw
nklfwvvhpggraildrveaklnldptkliptrhvmseygnmssacvhfildqtrkaslq
ngcsttgeglemgvlfgfgpgltietvvlksvpi
Timeline for d1xetb2: