Lineage for d1xeta1 (1xet A:6-238)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2916469Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 2916470Superfamily c.95.1: Thiolase-like [53901] (3 families) (S)
  5. 2917323Family c.95.1.0: automated matches [196908] (1 protein)
    not a true family
  6. 2917324Protein automated matches [196909] (83 species)
    not a true protein
  7. 2918243Species Scots pine (Pinus sylvestris) [TaxId:3349] [225067] (3 PDB entries)
  8. 2918252Domain d1xeta1: 1xet A:6-238 [203133]
    automated match to d1cmla1
    complexed with 3io, mca

Details for d1xeta1

PDB Entry: 1xet (more details), 2 Å

PDB Description: crystal structure of stilbene synthase from pinus sylvestris, complexed with methylmalonyl coa
PDB Compounds: (A:) Dihydropinosylvin synthase

SCOPe Domain Sequences for d1xeta1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xeta1 c.95.1.0 (A:6-238) automated matches {Scots pine (Pinus sylvestris) [TaxId: 3349]}
fegfrklqradgfasilaigtanppnavdqstypdfyfritgnehntelkdkfkricers
aikqrymylteeilkknpdvcafvevpsldarqamlamevprlakeaaekaiqewgqsks
githlifcstttpdlpgadfevakllglhpsvkrvgvfqhgcfaggtvlrmakdlaennr
garvlvicsettavtfrgpsethldslvgqalfgdgasalivgadpipqveka

SCOPe Domain Coordinates for d1xeta1:

Click to download the PDB-style file with coordinates for d1xeta1.
(The format of our PDB-style files is described here.)

Timeline for d1xeta1: