Lineage for d1xesc2 (1xes C:239-392)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2164457Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 2164458Superfamily c.95.1: Thiolase-like [53901] (3 families) (S)
  5. 2165221Family c.95.1.0: automated matches [196908] (1 protein)
    not a true family
  6. 2165222Protein automated matches [196909] (60 species)
    not a true protein
  7. 2165909Species Scots pine (Pinus sylvestris) [TaxId:3349] [225067] (2 PDB entries)
  8. 2165915Domain d1xesc2: 1xes C:239-392 [203130]
    automated match to d1bi5a2
    complexed with 3io

Details for d1xesc2

PDB Entry: 1xes (more details), 1.7 Å

PDB Description: crystal structure of stilbene synthase from pinus sylvestris
PDB Compounds: (C:) Dihydropinosylvin synthase

SCOPe Domain Sequences for d1xesc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xesc2 c.95.1.0 (C:239-392) automated matches {Scots pine (Pinus sylvestris) [TaxId: 3349]}
cfeivwtaqtvvpnsegaiggkvrevgltfqlkgavpdlisaniencmveafsqfkisdw
nklfwvvhpggraildrveaklnldptkliptrhvmseygnmssacvhfildqtrkaslq
ngcsttgeglemgvlfgfgpgltietvvlksvpi

SCOPe Domain Coordinates for d1xesc2:

Click to download the PDB-style file with coordinates for d1xesc2.
(The format of our PDB-style files is described here.)

Timeline for d1xesc2: