Class b: All beta proteins [48724] (177 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species) VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species |
Species Norway rat (Rattus norvegicus) [TaxId:10116] [88560] (16 PDB entries) |
Domain d1bfod1: 1bfo D:1-121 [20313] Other proteins in same PDB: d1bfoa1, d1bfoa2, d1bfob2, d1bfoc1, d1bfoc2, d1bfod2, d1bfoe1, d1bfoe2, d1bfof2, d1bfog1, d1bfog2, d1bfoh2 part of therapeutic monoclonal antibody CAMPATH-1G |
PDB Entry: 1bfo (more details), 2.6 Å
SCOPe Domain Sequences for d1bfod1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bfod1 b.1.1.1 (D:1-121) Immunoglobulin heavy chain variable domain, VH {Norway rat (Rattus norvegicus) [TaxId: 10116]} evkllesggglvqpggsmrlscagsgftftdfymnwirqpagkapewlgfirdkakgytt eynpsvkgrftisrdntqnmlylqmntlraedtatyycareghtaapfdywgqgvmvtvs s
Timeline for d1bfod1: