SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d1xesb2 (1xes B:239-392)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2146372Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 2146373Superfamily c.95.1: Thiolase-like [53901] (3 families) (S)
  5. 2147118Family c.95.1.0: automated matches [196908] (1 protein)
    not a true family
  6. 2147119Protein automated matches [196909] (57 species)
    not a true protein
  7. 2147668Species Scots pine (Pinus sylvestris) [TaxId:3349] [225067] (2 PDB entries)
  8. 2147672Domain d1xesb2: 1xes B:239-392 [203128]
    automated match to d1bi5a2
    complexed with 3io

Details for d1xesb2

PDB Entry: 1xes (more details), 1.7 Å

PDB Description: Crystal structure of stilbene synthase from Pinus sylvestris
PDB Compounds: (B:) Dihydropinosylvin synthase

SCOPe Domain Sequences for d1xesb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xesb2 c.95.1.0 (B:239-392) automated matches {Scots pine (Pinus sylvestris) [TaxId: 3349]}
cfeivwtaqtvvpnsegaiggkvrevgltfqlkgavpdlisaniencmveafsqfkisdw
nklfwvvhpggraildrveaklnldptkliptrhvmseygnmssacvhfildqtrkaslq
ngcsttgeglemgvlfgfgpgltietvvlksvpi

SCOPe Domain Coordinates for d1xesb2:

Click to download the PDB-style file with coordinates for d1xesb2.
(The format of our PDB-style files is described here.)

Timeline for d1xesb2: