Lineage for d1bfoc1 (1bfo C:1-107)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 6994Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 6995Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins)
  6. 7065Protein Immunoglobulin (variable domains of L and H chains) [48749] (183 species)
  7. 7275Species CAMPATH-1G igg2b monoclonal fab (rat), kappa L chain [48867] (1 PDB entry)
  8. 7278Domain d1bfoc1: 1bfo C:1-107 [20312]
    Other proteins in same PDB: d1bfoa2, d1bfob2, d1bfoc2, d1bfod2, d1bfoe2, d1bfof2, d1bfog2, d1bfoh2

Details for d1bfoc1

PDB Entry: 1bfo (more details), 2.6 Å

PDB Description: campath-1g igg2b rat monoclonal fab

SCOP Domain Sequences for d1bfoc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bfoc1 b.1.1.1 (C:1-107) Immunoglobulin (variable domains of L and H chains) {CAMPATH-1G igg2b monoclonal fab (rat), kappa L chain}
dikmtqspsflsasvgdrvtlnckasqnidkylnwyqqklgespklliyntnnlqtgips
rfsgsgsgtdftltisslqpedvatyfclqhisrprtfgtgtklelk

SCOP Domain Coordinates for d1bfoc1:

Click to download the PDB-style file with coordinates for d1bfoc1.
(The format of our PDB-style files is described here.)

Timeline for d1bfoc1: