Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.8: The "swivelling" beta/beta/alpha domain [52008] (10 superfamilies) 3 layers: b/b/a; the central sheet is parallel, and the other one is antiparallel; there are some variations in topology this domain is thought to be mobile in most multi-domain proteins known to contain it |
Superfamily c.8.5: GroEL apical domain-like [52029] (3 families) |
Family c.8.5.1: GroEL-like chaperone, apical domain [52030] (2 proteins) |
Protein GroEL, A domain [52031] (4 species) |
Species Escherichia coli [TaxId:562] [52032] (18 PDB entries) |
Domain d1xckk3: 1xck K:191-366 [203115] Other proteins in same PDB: d1xcka1, d1xcka2, d1xckb1, d1xckb2, d1xckc1, d1xckc2, d1xckd1, d1xckd2, d1xcke1, d1xcke2, d1xckf1, d1xckf2, d1xckg1, d1xckg2, d1xckh1, d1xckh2, d1xcki1, d1xcki2, d1xckj1, d1xckj2, d1xckk1, d1xckk2, d1xckl1, d1xckl2, d1xckm1, d1xckm2, d1xckn1, d1xckn2 automated match to d1mnfa2 complexed with k, mpd, peg, so4 |
PDB Entry: 1xck (more details), 2.92 Å
SCOPe Domain Sequences for d1xckk3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xckk3 c.8.5.1 (K:191-366) GroEL, A domain {Escherichia coli [TaxId: 562]} egmqfdrgylspyfinkpetgavelespfilladkkisniremlpvleavakagkpllii aedvegealatlvvntmrgivkvaavkapgfgdrrkamlqdiatltggtviseeigmele katledlgqakrvvinkdtttiidgvgeeaaiqgrvaqirqqieeatsdydreklq
Timeline for d1xckk3:
View in 3D Domains from other chains: (mouse over for more information) d1xcka1, d1xcka2, d1xcka3, d1xckb1, d1xckb2, d1xckb3, d1xckc1, d1xckc2, d1xckc3, d1xckd1, d1xckd2, d1xckd3, d1xcke1, d1xcke2, d1xcke3, d1xckf1, d1xckf2, d1xckf3, d1xckg1, d1xckg2, d1xckg3, d1xckh1, d1xckh2, d1xckh3, d1xcki1, d1xcki2, d1xcki3, d1xckj1, d1xckj2, d1xckj3, d1xckl1, d1xckl2, d1xckl3, d1xckm1, d1xckm2, d1xckm3, d1xckn1, d1xckn2, d1xckn3 |