SCOP 1.67: Domain d1bfob1: 1bfo B:1-121

Lineage for d1bfob1 (1bfo B:1-121)

Root: SCOP 1.67
Class b: All beta proteins [48724] (141 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (4 families)
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (24 proteins)

Protein Immunoglobulin heavy chain variable domain, VH [88543] (20 species)
VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species

Species Rat (Rattus norvegicus) [TaxId:10116] [88560] (14 PDB entries)
Domain d1bfob1: 1bfo B:1-121 [20311]
Other proteins in same PDB: d1bfoa1, d1bfoa2, d1bfob2, d1bfoc1, d1bfoc2, d1bfod2, d1bfoe1, d1bfoe2, d1bfof2, d1bfog1, d1bfog2, d1bfoh2

Details for d1bfob1

PDB Entry: 1bfo (more details), 2.6 Å

PDB Description: campath-1g igg2b rat monoclonal fab

SCOP Domain Sequences for d1bfob1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bfob1 b.1.1.1 (B:1-121) Immunoglobulin heavy chain variable domain, VH {Rat (Rattus norvegicus)}
evkllesggglvqpggsmrlscagsgftftdfymnwirqpagkapewlgfirdkakgytt
eynpsvkgrftisrdntqnmlylqmntlraedtatyycareghtaapfdywgqgvmvtvs
s

SCOP Domain Coordinates for d1bfob1:

Click to download the PDB-style file with coordinates for d1bfob1.
(The format of our PDB-style files is described here.)

Timeline for d1bfob1: