SCOPe 2.08: Domain d1xcke3: 1xck E:191-366

Lineage for d1xcke3 (1xck E:191-366)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.8: The 'swivelling' beta/beta/alpha domain [52008] (10 superfamilies)
   3 layers: b/b/a; the central sheet is parallel, and the other one is antiparallel; there are some variations in topology
   this domain is thought to be mobile in most multi-domain proteins known to contain it

4. Superfamily c.8.5: GroEL apical domain-like [52029] (3 families)

5. Family c.8.5.1: GroEL-like chaperone, apical domain [52030] (2 proteins)

6. Protein GroEL, A domain [52031] (4 species)

7. Species Escherichia coli [TaxId:562] [52032] (18 PDB entries)

8. Domain d1xcke3: 1xck E:191-366 [203097]
   Other proteins in same PDB: d1xcka1, d1xcka2, d1xckb1, d1xckb2, d1xckc1, d1xckc2, d1xckd1, d1xckd2, d1xcke1, d1xcke2, d1xckf1, d1xckf2, d1xckg1, d1xckg2, d1xckh1, d1xckh2, d1xcki1, d1xcki2, d1xckj1, d1xckj2, d1xckk1, d1xckk2, d1xckl1, d1xckl2, d1xckm1, d1xckm2, d1xckn1, d1xckn2
   automated match to d1mnfa2
   complexed with k, mpd, peg, so4

Details for d1xcke3

PDB Entry: 1xck, 2.92 Å

PDB Description: Crystal structure of apo GroEL

PDB Compounds: (E:) 60 kda chaperonin

SCOPe Domain Sequences for d1xcke3:

Sequence; same for both SEQRES and ATOM records:

>d1xcke3 c.8.5.1 (E:191-366) GroEL, A domain {Escherichia coli [TaxId: 562]}
egmqfdrgylspyfinkpetgavelespfilladkkisniremlpvleavakagkpllii
aedvegealatlvvntmrgivkvaavkapgfgdrrkamlqdiatltggtviseeigmele
katledlgqakrvvinkdtttiidgvgeeaaiqgrvaqirqqieeatsdydreklq

Timeline for d1xcke3:

• d1xcke3 first appeared in SCOPe 2.03
  
• d1xcke3 appears in SCOPe 2.07