Lineage for d1xckb3 (1xck B:191-366)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2850950Fold c.8: The 'swivelling' beta/beta/alpha domain [52008] (10 superfamilies)
    3 layers: b/b/a; the central sheet is parallel, and the other one is antiparallel; there are some variations in topology
    this domain is thought to be mobile in most multi-domain proteins known to contain it
  4. 2851157Superfamily c.8.5: GroEL apical domain-like [52029] (3 families) (S)
  5. 2851158Family c.8.5.1: GroEL-like chaperone, apical domain [52030] (2 proteins)
  6. 2851159Protein GroEL, A domain [52031] (4 species)
  7. 2851160Species Escherichia coli [TaxId:562] [52032] (18 PDB entries)
  8. 2851187Domain d1xckb3: 1xck B:191-366 [203088]
    Other proteins in same PDB: d1xcka1, d1xcka2, d1xckb1, d1xckb2, d1xckc1, d1xckc2, d1xckd1, d1xckd2, d1xcke1, d1xcke2, d1xckf1, d1xckf2, d1xckg1, d1xckg2, d1xckh1, d1xckh2, d1xcki1, d1xcki2, d1xckj1, d1xckj2, d1xckk1, d1xckk2, d1xckl1, d1xckl2, d1xckm1, d1xckm2, d1xckn1, d1xckn2
    automated match to d1mnfa2
    complexed with k, mpd, peg, so4

Details for d1xckb3

PDB Entry: 1xck (more details), 2.92 Å

PDB Description: Crystal structure of apo GroEL
PDB Compounds: (B:) 60 kda chaperonin

SCOPe Domain Sequences for d1xckb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xckb3 c.8.5.1 (B:191-366) GroEL, A domain {Escherichia coli [TaxId: 562]}
egmqfdrgylspyfinkpetgavelespfilladkkisniremlpvleavakagkpllii
aedvegealatlvvntmrgivkvaavkapgfgdrrkamlqdiatltggtviseeigmele
katledlgqakrvvinkdtttiidgvgeeaaiqgrvaqirqqieeatsdydreklq

SCOPe Domain Coordinates for d1xckb3:

Click to download the PDB-style file with coordinates for d1xckb3.
(The format of our PDB-style files is described here.)

Timeline for d1xckb3: