SCOPe 2.08: Domain d1x9qa2: 1x9q A:153-268

Lineage for d1x9qa2 (1x9q A:153-268)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d1x9qa2: 1x9q A:153-268 [203082]
   automated match to d1nqba1
   complexed with act, flu

Details for d1x9qa2

PDB Entry: 1x9q, 1.5 Å

PDB Description: 4m5.3 anti-fluorescein single chain antibody fragment (scfv)

PDB Compounds: (A:) 4m5.3 anti-fluorescein single chain antibody fragment

SCOPe Domain Sequences for d1x9qa2:

Sequence; same for both SEQRES and ATOM records:

>d1x9qa2 b.1.1.0 (A:153-268) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vkldetggglvqpggamklscvtsgftfghywmnwvrqspekglewvaqfrnkpynyety
ysdsvkgrftisrddskssvylqmnnlrvedtgiyyctgasygmeylgqgtsvtvs

Timeline for d1x9qa2:

• d1x9qa2 first appeared in SCOPe 2.03
  
• d1x9qa2 appears in SCOPe 2.07