![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.95: Thiolase-like [53900] (1 superfamily) consists of two similar domains related by pseudo dyad; duplication 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest |
![]() | Superfamily c.95.1: Thiolase-like [53901] (3 families) ![]() |
![]() | Family c.95.1.2: Chalcone synthase-like [53914] (15 proteins) |
![]() | Protein 3-hydroxy-3-methylglutaryl CoA synthase MvaS, N-terminal domain [419028] (2 species) most similar to FabH |
![]() | Species Enterococcus faecalis [TaxId:1351] [419510] (4 PDB entries) |
![]() | Domain d1x9ea1: 1x9e A:1-167 [203077] Other proteins in same PDB: d1x9ea2, d1x9eb2 automated match to d1tvza1 complexed with so4 |
PDB Entry: 1x9e (more details), 2.4 Å
SCOPe Domain Sequences for d1x9ea1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1x9ea1 c.95.1.2 (A:1-167) 3-hydroxy-3-methylglutaryl CoA synthase MvaS, N-terminal domain {Enterococcus faecalis [TaxId: 1351]} mtigidkisffvppyyidmtalaearnvdpgkfhigigqdqmavnpisqdivtfaanaae ailtkedkeaidmvivgtessideskaaavvlhrlmgiqpfarsfeikeacygataglql aknhvalhpdkkvlvvaadiakyglnsggeptqgagavamlvasepr
Timeline for d1x9ea1: