SCOPe 2.08: Domain d1x9ea1: 1x9e A:1-167

Lineage for d1x9ea1 (1x9e A:1-167)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.95: Thiolase-like [53900] (1 superfamily)
   consists of two similar domains related by pseudo dyad; duplication
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest

4. Superfamily c.95.1: Thiolase-like [53901] (3 families)

5. Family c.95.1.2: Chalcone synthase-like [53914] (15 proteins)

6. Protein 3-hydroxy-3-methylglutaryl CoA synthase MvaS, N-terminal domain [419028] (2 species)
   most similar to FabH

7. Species Enterococcus faecalis [TaxId:1351] [419510] (4 PDB entries)

8. Domain d1x9ea1: 1x9e A:1-167 [203077]
   Other proteins in same PDB: d1x9ea2, d1x9eb2
   automated match to d1tvza1
   complexed with so4

Details for d1x9ea1

PDB Entry: 1x9e, 2.4 Å

PDB Description: Crystal structure of HMG-CoA synthase from Enterococcus faecalis

PDB Compounds: (A:) HMG-CoA synthase

SCOPe Domain Sequences for d1x9ea1:

Sequence; same for both SEQRES and ATOM records:

>d1x9ea1 c.95.1.2 (A:1-167) 3-hydroxy-3-methylglutaryl CoA synthase MvaS, N-terminal domain {Enterococcus faecalis [TaxId: 1351]}
mtigidkisffvppyyidmtalaearnvdpgkfhigigqdqmavnpisqdivtfaanaae
ailtkedkeaidmvivgtessideskaaavvlhrlmgiqpfarsfeikeacygataglql
aknhvalhpdkkvlvvaadiakyglnsggeptqgagavamlvasepr

Timeline for d1x9ea1:

• d1x9ea1 first appeared in SCOPe 2.03
  
• d1x9ea1 appears in SCOPe 2.07