Lineage for d1x0xa1 (1x0x A:1-193)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2449371Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2449372Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2454167Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2454168Protein automated matches [190069] (309 species)
    not a true protein
  7. 2455436Species Human (Homo sapiens) [TaxId:9606] [186944] (62 PDB entries)
  8. 2455652Domain d1x0xa1: 1x0x A:1-193 [203069]
    Other proteins in same PDB: d1x0xa2, d1x0xa3
    automated match to d1evya2
    complexed with nad, so4

Details for d1x0xa1

PDB Entry: 1x0x (more details), 2.75 Å

PDB Description: co-structure of homo sapiens glycerol-3-phosphate dehydrogenase 1 complex with nad
PDB Compounds: (A:) Glycerol-3-phosphate dehydrogenase [NAD+], cytoplasmic

SCOPe Domain Sequences for d1x0xa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1x0xa1 c.2.1.0 (A:1-193) automated matches {Human (Homo sapiens) [TaxId: 9606]}
maskkvcivgsgnwgsaiakivggnaaqlaqfdprvtmwvfeediggkklteiintqhen
vkylpghklppnvvavpdvvqaaedadilifvvphqfigkicdqlkghlkanatgislik
gvdegpnglklisevigerlgipmsvlmganiasevadekfcettigckdpaqgqllkel
mqtpnfritvvqe

SCOPe Domain Coordinates for d1x0xa1:

Click to download the PDB-style file with coordinates for d1x0xa1.
(The format of our PDB-style files is described here.)

Timeline for d1x0xa1: