![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
![]() | Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) ![]() |
![]() | Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
![]() | Protein automated matches [190069] (254 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [186944] (47 PDB entries) |
![]() | Domain d1x0xa1: 1x0x A:1-193 [203069] Other proteins in same PDB: d1x0xa2, d1x0xa3 automated match to d1evya2 complexed with nad, so4 |
PDB Entry: 1x0x (more details), 2.75 Å
SCOPe Domain Sequences for d1x0xa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1x0xa1 c.2.1.0 (A:1-193) automated matches {Human (Homo sapiens) [TaxId: 9606]} maskkvcivgsgnwgsaiakivggnaaqlaqfdprvtmwvfeediggkklteiintqhen vkylpghklppnvvavpdvvqaaedadilifvvphqfigkicdqlkghlkanatgislik gvdegpnglklisevigerlgipmsvlmganiasevadekfcettigckdpaqgqllkel mqtpnfritvvqe
Timeline for d1x0xa1: