Lineage for d1x0va1 (1x0v A:2-193)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1346342Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 1346343Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 1349962Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 1349963Protein automated matches [190069] (159 species)
    not a true protein
  7. 1350556Species Human (Homo sapiens) [TaxId:9606] [186944] (28 PDB entries)
  8. 1350604Domain d1x0va1: 1x0v A:2-193 [203065]
    Other proteins in same PDB: d1x0va2, d1x0vb2
    automated match to d1evya2
    complexed with so4

Details for d1x0va1

PDB Entry: 1x0v (more details), 2.3 Å

PDB Description: Crystal Structure of Homo Sapien Glycerol-3-Phosphate Dehydrogenase 1
PDB Compounds: (A:) Glycerol-3-phosphate dehydrogenase [NAD+], cytoplasmic

SCOPe Domain Sequences for d1x0va1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1x0va1 c.2.1.0 (A:2-193) automated matches {Human (Homo sapiens) [TaxId: 9606]}
askkvcivgsgnwgsaiakivggnaaqlaqfdprvtmwvfeediggkklteiintqhenv
kylpghklppnvvavpdvvqaaedadilifvvphqfigkicdqlkghlkanatgislikg
vdegpnglklisevigerlgipmsvlmganiasevadekfcettigckdpaqgqllkelm
qtpnfritvvqe

SCOPe Domain Coordinates for d1x0va1:

Click to download the PDB-style file with coordinates for d1x0va1.
(The format of our PDB-style files is described here.)

Timeline for d1x0va1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1x0va2