SCOPe 2.07: Domain d1b2wl1: 1b2w L:1-107

Lineage for d1b2wl1 (1b2w L:1-107)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species)
   VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Engineered (including hybrid species) [88533] (63 PDB entries)
   SQ NA # humanized antidoby; bactericidal Fab-h6831 ! SQ NA # Humanized antibody ! SQ NA # humanized antibody ! SQ NA # engineered antibody

8. Domain d1b2wl1: 1b2w L:1-107 [20306]
   Other proteins in same PDB: d1b2wh1, d1b2wh2, d1b2wl2
   part of a humanized anti-gamma-interferon Fab

Details for d1b2wl1

PDB Entry: 1b2w, 2.9 Å

PDB Description: comparison of the three-dimensional structures of a humanized and a chimeric fab of an anti-gamma-interferon antibody

PDB Compounds: (L:) protein (antibody (light chain))

SCOPe Domain Sequences for d1b2wl1:

Sequence; same for both SEQRES and ATOM records:

>d1b2wl1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Engineered (including hybrid species)}
diqmtqspstlsasvgdrvtitckasenvdtyvswyqqkpgkapklliygasnrytgvps
rfsgsgsgtdftltisslqpddfatyycgqsynypftfgqgtkvevk

Timeline for d1b2wl1:

• d1b2wl1 first appeared (with stable ids) in SCOP 1.55
  
• d1b2wl1 appears in SCOPe 2.06
  
• d1b2wl1 appears in the current release, SCOPe 2.08