Lineage for d1axth1 (1axt H:1-113)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 450778Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 450779Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 450780Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (27 proteins)
  6. 450916Protein Immunoglobulin heavy chain variable domain, VH [88543] (20 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 451027Species Mouse (Mus musculus), cluster 1 [TaxId:10090] [88548] (42 PDB entries)
  8. 451054Domain d1axth1: 1axt H:1-113 [20305]
    Other proteins in same PDB: d1axth2, d1axtl1, d1axtl2
    part of catalytic Fab 33F12 with an aldolase activity

Details for d1axth1

PDB Entry: 1axt (more details), 2.15 Å

PDB Description: immune versus natural selection: antibody aldolases with the rates of natural enzymes

SCOP Domain Sequences for d1axth1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1axth1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 1}
evkleesggglvqpggsmklscvvsgltfsrfwmswvrqspekglewvaeirlksdnyat
hyaesvkgkftisrddsksrlylqmnslrtedtgiyyckiyfysfsywgqgtlvtvsa

SCOP Domain Coordinates for d1axth1:

Click to download the PDB-style file with coordinates for d1axth1.
(The format of our PDB-style files is described here.)

Timeline for d1axth1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1axth2