| Class b: All beta proteins [48724] (180 folds) |
| Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) ![]() |
| Family b.29.1.0: automated matches [191363] (1 protein) not a true family |
| Protein automated matches [190437] (70 species) not a true protein |
| Species Agrocybe cylindracea [TaxId:64608] [225007] (7 PDB entries) |
| Domain d1ww7d_: 1ww7 D: [203048] automated match to d2r0hb_ complexed with so4 |
PDB Entry: 1ww7 (more details), 1.9 Å
SCOPe Domain Sequences for d1ww7d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ww7d_ b.29.1.0 (D:) automated matches {Agrocybe cylindracea [TaxId: 64608]}
ttsavniynisagasvdlaapvttgdivtffssalnlsagagspnntalnllsengayll
hiafrlqenvivfnsrqpnapwlveqrvsnvanqfigsggkamvtvfdhgdkyqvvinek
tviqytkqisgttsslsynstegtsifstvveavtytgla
Timeline for d1ww7d_: